[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 32
DDBJ      :32           single-stranded DNA binding protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
b.40.4
:295 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->239 2a1kA PDBj 1e-86 67.1 %
:RPS:PDB   27->239 2a1kA PDBj 4e-55 67.1 %
:RPS:SCOP  27->237 1gpcA  b.40.4.7 * 4e-19 66.8 %
:HMM:SCOP  22->239 1gpcA_ b.40.4.7 * 1.3e-101 63.8 %
:RPS:PFM   27->116 PF08804 * gp32 4e-39 78.4 %
:HMM:PFM   27->116 PF08804 * gp32 3.6e-47 71.1 90/94  
:BLT:SWISS 1->237 VHED_BPT2 5e-92 65.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81532.1 GT:GENE 32 GT:PRODUCT single-stranded DNA binding protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(142117..143004) GB:FROM 142117 GB:TO 143004 GB:DIRECTION - GB:GENE 32 GB:PRODUCT single-stranded DNA binding protein GB:NOTE similar to T4 accession NP_049854.1; DNA replication, recombination and repair protein, helix-destabilizing; gp32 GB:PROTEIN_ID AAQ81532.1 GB:DB_XREF GI:34732995 GB:GENE:GENE 32 LENGTH 295 SQ:AASEQ MFKRSNPSQLQAQLAALKGNQGGFGGDKNEWRLKTDASGNGQAVIRFLPGKGDEGLPFVKLINHGFKKNNKWYIENCSSTHGDFDNCPVCQHLSRNDSYNTNKEEYSLLKRKTSYWANILVIKDPATPENEGKVMKMRFGMKIMEKITSMINVDPEMGETPVDVTCVFEGANFVYKTKKVGGFTNYDDCKFLSCSEIPKINDPEFQKFLDAGMEDISKLVAPSEFKSLDDLEKKFKQIMGTSLAAGKAASAAGSLNAELNEFDAELTSFESDTPANAFEQTGGTDLDDDLDSLLG GT:EXON 1|1-295:0| BL:SWS:NREP 1 BL:SWS:REP 1->237|VHED_BPT2|5e-92|65.4|237/293| SEG 240->259|gtslaagkaasaagslnael| SEG 285->294|dldddldsll| BL:PDB:NREP 1 BL:PDB:REP 27->239|2a1kA|1e-86|67.1|213/215| RP:PDB:NREP 1 RP:PDB:REP 27->239|2a1kA|4e-55|67.1|213/215| RP:PFM:NREP 1 RP:PFM:REP 27->116|PF08804|4e-39|78.4|88/88|gp32| HM:PFM:NREP 1 HM:PFM:REP 27->116|PF08804|3.6e-47|71.1|90/94|gp32| GO:PFM:NREP 1 GO:PFM GO:0003697|"GO:single-stranded DNA binding"|PF08804|IPR012339| RP:SCP:NREP 1 RP:SCP:REP 27->237|1gpcA|4e-19|66.8|211/218|b.40.4.7| HM:SCP:REP 22->239|1gpcA_|1.3e-101|63.8|218/0|b.40.4.7|1/1|Nucleic acid-binding proteins| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 213 STR:RPRED 72.2 SQ:SECSTR ##########################ccccccccccTTccEEEEEEEcccccTTcccEEEEEEEEEEETTEEEEEEcGGGGTccTTcHHHHHHHHTTHHHHcHHHHHHHccEEEEEEEEEEEEcTTcGGGTTcEEEEEEcHHHHHHHHHHHcccTTTTcccccTTcTTTcEEEEEEEEEETTEEEcTTcEEEEEcccTTTTcHHHHHHHHHHcccGGGGGcGGGcccHHHHHHHHHHHH######################################################## DISOP:02AL 1-29| PSIPRED ccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEccccccccccEEEEEEccccccccEEEEccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHcEEEEEEccccccccccEEEEHHHHHHHHHHHHHHHccccccccccEEEEEccccEEEEEEEEEcccccccccccccHHHccccccHHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccHHccccccHHHHHHHHc //