[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 33
DDBJ      :33           late promoter transcription accessory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->38 PF10400 * Vir_act_alpha_C 0.00062 31.8 22/90  
:BLT:SWISS 7->85 VG33_BPT4 5e-16 44.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81534.1 GT:GENE 33 GT:PRODUCT late promoter transcription accessory protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(143743..144000) GB:FROM 143743 GB:TO 144000 GB:DIRECTION - GB:GENE 33 GB:PRODUCT late promoter transcription accessory protein GB:NOTE similar to T4 accession NP_049857.1; connector protein between gp45 of replisome and gp55 late sigma factor; gp33 GB:PROTEIN_ID AAQ81534.1 GB:DB_XREF GI:34732997 GB:GENE:GENE 33 LENGTH 85 SQ:AASEQ MSNPNNLSDKTSNGLEIEALVVKEGLTYMEACIQWLEENSLEISNCQKYIPRALIDKLSQECIESDMLRPSIVRSMTRNTLDFLM GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 7->85|VG33_BPT4|5e-16|44.3|79/112| HM:PFM:NREP 1 HM:PFM:REP 17->38|PF10400|0.00062|31.8|22/90|Vir_act_alpha_C| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccHHHHHc //