[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 4
DDBJ      :4            head completion protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
:150 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   57->139 PF08722 * TnsA_N 2.6e-07 30.2 53/88  
:BLT:SWISS 1->150 VG50_BPT4 5e-45 53.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81455.1 GT:GENE 4 GT:PRODUCT head completion protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(77058..77510) GB:FROM 77058 GB:TO 77510 GB:DIRECTION - GB:GENE 4 GB:PRODUCT head completion protein GB:NOTE similar to T4 accession NP_049755.1; T4 gene synonyms: 65, 50; gp4 GB:PROTEIN_ID AAQ81455.1 GB:DB_XREF GI:34732917 GB:GENE:GENE 4 LENGTH 150 SQ:AASEQ MAYSGKFRPKNLSKYNGDPNKITYRSSWEAWLMKWCDQSASVISWSSEEVIIPYFSNADGKRRRYFMDFYVKMVTGDVFLFEVKPEKECRPPVMPSTNTAKAKKNFISEMYTWQVNTDKWKAAQALCESKGWNFKIITEVTLKSHFGWRG GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 1->150|VG50_BPT4|5e-45|53.0|149/150| SEG 39->52|sasviswsseevii| HM:PFM:NREP 1 HM:PFM:REP 57->139|PF08722|2.6e-07|30.2|53/88|TnsA_N| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,96-96| PSIPRED cccccccccccHHHHcccccEEEEcccHHHHHHHHHcccccEEEEccccEEEEEEEcccccEEEEccEEEEEEccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHcccc //