Bacteriophage 44RR2.8t (bp441)
Gene : 45.2
DDBJ      :45.2         hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:62 amino acids
:HMM:PFM   14->41 PF00564 * PB1 1.8e-05 39.3 28/84  
:BLT:SWISS 10->59 VG452_BPR69 3e-05 38.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81361.1 GT:GENE 45.2 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(25874..26062) GB:FROM 25874 GB:TO 26062 GB:DIRECTION - GB:GENE 45.2 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049668.1 GB:PROTEIN_ID AAQ81361.1 GB:DB_XREF GI:34732823 GB:GENE:GENE 45.2 LENGTH 62 SQ:AASEQ MFYNLPQTTPEIRSYELTDETGHLRVVVTDEDLKSAFSEADIRKLRSNRHSYYNLTEIFPDQ GT:EXON 1|1-62:0| BL:SWS:NREP 1 BL:SWS:REP 10->59|VG452_BPR69|3e-05|38.8|49/62| HM:PFM:NREP 1 HM:PFM:REP 14->41|PF00564|1.8e-05|39.3|28/84|PB1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 62-63| PSIPRED ccccccccccccEEEEEcccccEEEEEEEcHHHHHHHcHHHHHHHHHcccHHEEEHHccccc //