[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 47
DDBJ      :47           recombination endonuclease subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
d.159.1
:355 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   21->229 3e0jC PDBj 1e-13 12.0 %
:RPS:SCOP  1->229 1t70A  d.159.1.9 * 2e-09 10.7 %
:HMM:SCOP  1->290 1ii7A_ d.159.1.4 * 1.6e-35 24.0 %
:RPS:PFM   1->87 PF00149 * Metallophos 5e-04 36.8 %
:HMM:PFM   1->88 PF00149 * Metallophos 1.5e-07 23.4 77/200  
:BLT:SWISS 1->353 EXO1_BPT4 3e-92 49.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81363.1 GT:GENE 47 GT:PRODUCT recombination endonuclease subunit GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(27761..28828) GB:FROM 27761 GB:TO 28828 GB:DIRECTION - GB:GENE 47 GB:PRODUCT recombination endonuclease subunit GB:NOTE gp46/gp47 subunit required for recombination and host-DNA degradation; similar to T4 accession NP_049672.1; gp47 GB:PROTEIN_ID AAQ81363.1 GB:DB_XREF GI:34732825 GB:GENE:GENE 47 LENGTH 355 SQ:AASEQ MKILHLGDLHNGVKDDDPWHEDIVEHAFVQAIDYSKANGITQWLQSGDFFDVRKAVSQRTMNFVRTRLTPKLKEAGITCFVIVGNHDMQKKDRIHPNSVTEILGKDDTYVVIDEPTTVNFEGLDYDLIPWMCKENASDIFEFVKKSDSPWCLGHWELSGFYFYKNIPSSGYSADFLKKYEKVVSGHFHTQSDGGNIHYIGTPYTITAGDEDEPRGFWILDTETRDFEFVPNAKTWHKRLTYPGVTPEEIRSCSGCSVRLIANEVDAGLTKVEFLLSRVVHDLRTINKAVKVEVDSSTDISDDGETIDVQAASISEGPKTIMGLFAETVKNSAIDTDHKDAIIMMANELYAEASTL GT:EXON 1|1-355:0| BL:SWS:NREP 1 BL:SWS:REP 1->353|EXO1_BPT4|3e-92|49.1|338/339| RP:PDB:NREP 1 RP:PDB:REP 21->229|3e0jC|1e-13|12.0|208/409| RP:PFM:NREP 1 RP:PFM:REP 1->87|PF00149|5e-04|36.8|76/193|Metallophos| HM:PFM:NREP 1 HM:PFM:REP 1->88|PF00149|1.5e-07|23.4|77/200|Metallophos| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00149|IPR004843| RP:SCP:NREP 1 RP:SCP:REP 1->229|1t70A|2e-09|10.7|214/255|d.159.1.9| HM:SCP:REP 1->290|1ii7A_|1.6e-35|24.0|275/333|d.159.1.4|1/1|Metallo-dependent phosphatases| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 271 STR:RPRED 76.3 SQ:SECSTR cEEEEEcccccccTTcccTTHHHHTHccccHHHHHHHTTEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHTTccEEEEccTTcccccccccccccTTccHHHHTcTTEEEccccEEEEETTEEEEEcccHHHHHHHHHcccccHHHHHHHHHHcTcccTTcccccccTTcccccccEEEEEEEccEEEEEEcccccEEEEEEEEcHHHHcEEEEEETTTTEEEEEEEETTEEEEEEEETTEEEEEEcccccEEEEEEEEcHHHHHHH#################################################################################### PSIPRED cEEEEEEcHHcccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHcccccEEEEccccEEEEccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccEEEEccEEEEcccccEEEccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEcccccHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcc //