[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 5.1
DDBJ      :5.1          hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   108->134 PF08464 * Gemini_AC4_5_2 0.00028 46.2 26/43  
:BLT:SWISS 16->159 Y07E_BPT4 4e-25 45.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81456.1 GT:GENE 5.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(77510..78004) GB:FROM 77510 GB:TO 78004 GB:DIRECTION - GB:GENE 5.1 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049760.1; gp5.1 GB:PROTEIN_ID AAQ81456.1 GB:DB_XREF GI:34732918 GB:GENE:GENE 5.1 LENGTH 164 SQ:AASEQ MSDILPASTILPVTRENTPVSQTFTANLTEAGASLVSITVTQVTPNEGIIAAGSSFSGEYTGVFSLNGGLKYRLKTGERLTASKWEELPSPLIADLYSFEAPQSLEKTFTYSVVMIYDVVVPVEPGLPVNPPVRHTMQKTYSQKVVGTWTIWANNLRDYVNRGR GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 16->159|Y07E_BPT4|4e-25|45.1|142/164| TM:NTM 1 TM:REGION 107->129| HM:PFM:NREP 1 HM:PFM:REP 108->134|PF08464|0.00028|46.2|26/43|Gemini_AC4_5_2| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------1-1-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,164-165| PSIPRED ccEEccccccccccccccEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEccccEEEEEccccEEEEccHHHcccccccEEEEEEcccccEEEEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEEcHHHHHHHHHHHHHccc //