[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 5.4
DDBJ      :5.4          hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
:97 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   67->81 PF05488 * PAAR_motif 9.1e-05 46.7 15/25  
:HMM:PFM   24->68 PF00753 * Lactamase_B 0.00032 21.9 32/194  
:BLT:SWISS 1->97 Y08B_BPT4 3e-29 57.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81459.1 GT:GENE 5.4 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 80425..80718 GB:FROM 80425 GB:TO 80718 GB:DIRECTION + GB:GENE 5.4 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049763.1 GB:PROTEIN_ID AAQ81459.1 GB:DB_XREF GI:34732921 GB:GENE:GENE 5.4 LENGTH 97 SQ:AASEQ MPGLTYDMAWTTGHDTYPPTRIRATQGKVFVDGIRVVVAGDTIVPHTNTVEPYDTHSGYVIPTTSKIYVGGKPAASIGDPTSDGDTIAQSSSKVFIK GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 1->97|Y08B_BPT4|3e-29|57.7|97/97| HM:PFM:NREP 2 HM:PFM:REP 67->81|PF05488|9.1e-05|46.7|15/25|PAAR_motif| HM:PFM:REP 24->68|PF00753|0.00032|21.9|32/194|Lactamase_B| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEccccccccccccccEEEcccccEEEccEEEEEEcccEEEcccccccccccccEEEccccEEEEccEEEEEEccccccccEEEEccccEEEc //