[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 53
DDBJ      :53           baseplate wedge subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->177 PF11246 * Phage_gp53 1e-44 57.1 %
:HMM:PFM   1->178 PF11246 * Phage_gp53 6.2e-78 53.4 178/193  
:BLT:SWISS 1->178 VG53_BPT4 2e-51 53.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81458.1 GT:GENE 53 GT:PRODUCT baseplate wedge subunit GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(79816..80355) GB:FROM 79816 GB:TO 80355 GB:DIRECTION - GB:GENE 53 GB:PRODUCT baseplate wedge subunit GB:NOTE similar to T4 accession NP_049756.1; gp53 GB:PROTEIN_ID AAQ81458.1 GB:DB_XREF GI:34732920 GB:GENE:GENE 53 LENGTH 179 SQ:AASEQ MIFSFFDPISYQGKETTDIFKNYRAYFNRVVVKYKPEVYWLSGSPRPEAVAHELYGNQQLYWVLLMLNNTYDPFYDWLTSQDAAYQYAEQQYPVNQIAYHIDANGEKYWNLVEDPDFPQNWYDKGDKARMHVQYVGPLRAVDTLEAQVSLNESRRRIMIINPADINAFLSDMIREMEKV GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 1->178|VG53_BPT4|2e-51|53.4|178/196| SEG 83->92|aayqyaeqqy| RP:PFM:NREP 1 RP:PFM:REP 1->177|PF11246|1e-44|57.1|177/193|Phage_gp53| HM:PFM:NREP 1 HM:PFM:REP 1->178|PF11246|6.2e-78|53.4|178/193|Phage_gp53| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 179-180| PSIPRED ccEEcccccccccEEHHHHHHHHHHHHHHHHccEEEEEEEEcccccHHHHHHHHccccHHHHHHHHHcccccccccccccHHHHHHHHHHHccccEEEEEEEccccEEcccEEccccccHHcccccHHHccccEEccccHHHHHHHHHHcccHHcEEEEEcHHHHHHHHHHHHHHHHcc //