[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 55.2
DDBJ      :55.2         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:112 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->107 2bp7A PDBj 4e-04 29.9 %
:HMM:PFM   6->54 PF09437 * Pombe_5TM 0.00017 34.8 46/256  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81373.1 GT:GENE 55.2 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(33708..34046) GB:FROM 33708 GB:TO 34046 GB:DIRECTION - GB:GENE 55.2 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049681.1 GB:PROTEIN_ID AAQ81373.1 GB:DB_XREF GI:34732835 GB:GENE:GENE 55.2 LENGTH 112 SQ:AASEQ MSNQFIAVRNFTVHTCAAKFATDNILGNRISEEQINAVENEVWEAATAAGVTGIGRQAIRSVIVQYISEEFGTQALGHTPTHIGPKTMAEDAYKKYQGKARKIRQEIYGSKK GT:EXON 1|1-112:0| BL:PDB:NREP 1 BL:PDB:REP 26->107|2bp7A|4e-04|29.9|77/407| HM:PFM:NREP 1 HM:PFM:REP 6->54|PF09437|0.00017|34.8|46/256|Pombe_5TM| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 68.8 SQ:SECSTR #########################TccHHHHHHHHHHHTTcccHHHHHHHHHHHHHHH##HHHHHHHHTTcccccccccc###ccTTcTTccccccHHHHHHHHTc##### DISOP:02AL 1-3,110-113| PSIPRED ccccEEEEEEEEHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccc //