[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 57B
DDBJ      :57B          hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  6/175   --->[See Alignment]
d.61.1
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->121 2d4gA PDBj 2e-10 16.1 %
:RPS:SCOP  7->114 1iuhA  d.61.1.2 * 1e-10 22.2 %
:HMM:PFM   77->111 PF10460 * Peptidase_M30 0.00027 28.6 35/366  
:HMM:PFM   6->26 PF07599 * DUF1563 0.0004 42.9 21/46  
:BLT:SWISS 6->142 VG57B_BPT4 3e-32 44.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81450.1 GT:GENE 57B GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(74185..74613) GB:FROM 74185 GB:TO 74613 GB:DIRECTION - GB:GENE 57B GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049750.1; gp57B GB:PROTEIN_ID AAQ81450.1 GB:DB_XREF GI:34732912 GB:GENE:GENE 57B LENGTH 142 SQ:AASEQ METPVGTYVACRFSEETLDAIQKIQEALPIFNPVPRDELHSTIIYSREEIPFIPSDMPTLLANSAELRVFETPTKNVLVLAFESSHMNKRFAQGMLLGASYDFDEYIPHITIAKDVGSSSFMGSYEFPIVSSHEYMEALDAD GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 6->142|VG57B_BPT4|3e-32|44.5|137/152| RP:PDB:NREP 1 RP:PDB:REP 8->121|2d4gA|2e-10|16.1|112/165| HM:PFM:NREP 2 HM:PFM:REP 77->111|PF10460|0.00027|28.6|35/366|Peptidase_M30| HM:PFM:REP 6->26|PF07599|0.0004|42.9|21/46|DUF1563| RP:SCP:NREP 1 RP:SCP:REP 7->114|1iuhA|1e-10|22.2|108/183|d.61.1.2| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 78.9 SQ:SECSTR #######EEEccccHHHHHHHHHHHHHHc##GGGGTccccccccccEEccGGGHHHHHHHHHHHHEEEEEEcTTcccEEEEEcccHHHHHHHHHTTGGccccccccccEEEEEccccHHHH##################### DISOP:02AL 1-2,142-143| PSIPRED cccccEEEEEEEEcHHHHHHHHHHHHHccccccccHHHEEEEEEEEHHcccccccccHHHHcccccEEEEEEccccEEEEEEccHHHHHHHHHHHHccccccccccccEEEEEEEccccccEEEEEEEEEcHHHcccccccc //