[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 59
DDBJ      :59           loader of gp41 DNA helicase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  8/175   --->[See Alignment]
a.120.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->216 1c1kA PDBj 4e-58 48.8 %
:RPS:PDB   1->215 1c1kA PDBj 1e-17 48.1 %
:RPS:SCOP  1->215 1c1kA  a.120.1.1 * 5e-18 48.1 %
:HMM:SCOP  1->217 1c1kA_ a.120.1.1 * 6.3e-87 51.4 %
:RPS:PFM   14->105 PF08993 * T4-helicase_N 6e-27 52.2 %
:RPS:PFM   113->216 PF08994 * T4-helicase_C 8e-26 54.9 %
:HMM:PFM   113->216 PF08994 * T4-helicase_C 1.7e-43 55.3 103/103  
:HMM:PFM   14->105 PF08993 * T4-helicase_N 1.5e-40 47.8 92/94  
:BLT:SWISS 1->216 VG59_BPT4 1e-57 48.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81533.1 GT:GENE 59 GT:PRODUCT loader of gp41 DNA helicase GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(143075..143734) GB:FROM 143075 GB:TO 143734 GB:DIRECTION - GB:GENE 59 GB:PRODUCT loader of gp41 DNA helicase GB:FUNCTION DNA replication and recombination protein for loading gp41 on ssDNA with gp31 and UvsX GB:NOTE similar to T4 accession NP_049856.1; gp59 GB:PROTEIN_ID AAQ81533.1 GB:DB_XREF GI:34732996 GB:GENE:GENE 59 LENGTH 219 SQ:AASEQ MIALRYPPRPDRFISAKGAFMLYLMIKQHMAGKYDVIKYSWGMKVTDATFNKRKDKYFFEKLSNKFHLKDMVEIYLATFIENPSGWAGDLVSDEAMTAHRELLGRHLRFPNIYREDIKNIVYFAEKLDVPLGKIMEYNTDKMTSPIFKLLQSGMISIETFLVIDSFLGILDKHDAMMSGDIIWQNWHTKLSGYRKLVVINKDTAKRKFIEHVKAFKDQV GT:EXON 1|1-219:0| BL:SWS:NREP 1 BL:SWS:REP 1->216|VG59_BPT4|1e-57|48.8|215/217| BL:PDB:NREP 1 BL:PDB:REP 1->216|1c1kA|4e-58|48.8|215/217| RP:PDB:NREP 1 RP:PDB:REP 1->215|1c1kA|1e-17|48.1|214/217| RP:PFM:NREP 2 RP:PFM:REP 14->105|PF08993|6e-27|52.2|92/94|T4-helicase_N| RP:PFM:REP 113->216|PF08994|8e-26|54.9|102/102|T4-helicase_C| HM:PFM:NREP 2 HM:PFM:REP 113->216|PF08994|1.7e-43|55.3|103/103|T4-helicase_C| HM:PFM:REP 14->105|PF08993|1.5e-40|47.8|92/94|T4-helicase_N| RP:SCP:NREP 1 RP:SCP:REP 1->215|1c1kA|5e-18|48.1|214/217|a.120.1.1| HM:SCP:REP 1->217|1c1kA_|6.3e-87|51.4|216/217|a.120.1.1|1/1|gene 59 helicase assembly protein| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 216 STR:RPRED 98.6 SQ:SECSTR cEEEcccccTTccccHHHHHHHHHHHHHHHTTcccTTTTTTcccccHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHcccGGGTTHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHTTcccGGGTcccTTTTccHHHHHHHTTcccHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHHHHHEEEcHHHHHHHHHHHHHHHH### DISOP:02AL 1-1,6-7,218-220| PSIPRED cEEEEEcccccEEEcHHHHHHHHHHHHHHHccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //