[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 61
DDBJ      :61           DNA primase subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  9/175   --->[See Alignment]
c.37.1g.41.3
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   14->72 1d0qA PDBj 1e-04 28.8 %
:RPS:PDB   123->305 1ddeA PDBj 3e-17 19.6 %
:RPS:SCOP  14->72 1d0qA  g.41.3.2 * 5e-05 28.8 %
:RPS:SCOP  129->284 1khtA  c.37.1.1 * 7e-13 12.4 %
:HMM:PFM   163->204 PF08275 * Toprim_N 3.4e-07 33.3 42/128  
:HMM:PFM   28->68 PF09526 * DUF2387 0.0003 31.4 35/71  
:BLT:SWISS 7->333 DNAP_BPT4 3e-93 51.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81349.1 GT:GENE 61 GT:PRODUCT DNA primase subunit GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(16295..17299) GB:FROM 16295 GB:TO 17299 GB:DIRECTION - GB:GENE 61 GB:PRODUCT DNA primase subunit GB:NOTE similar to T4 accession NP_049648.1; T4 gene synonym: 58; DNA replication primase; gp61 GB:PROTEIN_ID AAQ81349.1 GB:DB_XREF GI:34732811 GB:GENE:GENE 61 LENGTH 334 SQ:AASEQ MFADFLFAERAMMHLPKFKRKKGKFNSRCPICGDSQTDMNKARFWMYEKKGDWQVHCFNCGYHSNLGGYLKDREEELYREWLLERRKENNVFKPQVKTIAETFTKKMPVIEKLNYCTKLDTLPENHPIVKYVANRKIPKSAYSRLWFTKEWQKLVNSISPETYTRERSECRLVIPIFDENGDIQSFQGRALCVSPNKYITIKAHEDASKIYGMDTIDGNRMVWLMEGPLDSLFIQNAGAITGGSLALNEVPWKSTRVWVLDNEPFHPDTCKRLSRLIDSGERVVMWDKCPWPSKDINDMIIKDGATPEEIEKYFKDNTVSGLQAKLRFGKWKRA GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 7->333|DNAP_BPT4|3e-93|51.4|325/342| SEG 73->88|reeelyrewllerrke| RP:PDB:NREP 2 RP:PDB:REP 14->72|1d0qA|1e-04|28.8|52/102| RP:PDB:REP 123->305|1ddeA|3e-17|19.6|179/310| HM:PFM:NREP 2 HM:PFM:REP 163->204|PF08275|3.4e-07|33.3|42/128|Toprim_N| HM:PFM:REP 28->68|PF09526|0.0003|31.4|35/71|DUF2387| RP:SCP:NREP 2 RP:SCP:REP 14->72|1d0qA|5e-05|28.8|52/102|g.41.3.2| RP:SCP:REP 129->284|1khtA|7e-13|12.4|145/190|c.37.1.1| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-1-------------1---11----------111-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 87.7 SQ:SECSTR #############HHcccEEETTEEEEcccccccc#####cccEEEETTTTEE##EETTTccEEcHHHHHHHHHTccHHHHHHHHHHHHTccccTTcccHH###HHHHHHHHHHHHHHHHHHGGGHHHHHHHHHTTccHHHHHHTEEcccccHHHHHHcccHHHHHccccEEEEEEEcTTccEEEEEEEEcccccccEEEccccTTccGccTHHHccccccEEEEccHHHHHHHHHTTEcccccccHHHHHHccEEEEEEEEcHHHHHHHHHHGGGccTTcEEEEEEETccTTccHHHHHHHHHHcHHHHHHHHHH################## DISOP:02AL 90-105,332-335| PSIPRED cccHHHHHHHHHcccccEEEcccEEEEEccccccccccccccccEEEEEcccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHccccccHHHHHHHcccccccccccccEEEEEEEcccccEEEEEEEEcccccccccccccccccHHHcccccccccccEEEEEccccEEEEccEEEEEcccccHHHccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //