[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 61.1
DDBJ      :61.1         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->63 PF07068 * Gp23 3.6e-09 40.0 45/493  
:HMM:PFM   3->23 PF11006 * DUF2845 0.00054 38.1 21/87  
:BLT:SWISS 21->54 Y01K_BPT4 7e-09 61.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81350.1 GT:GENE 61.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(17340..17534) GB:FROM 17340 GB:TO 17534 GB:DIRECTION - GB:GENE 61.1 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049649.1; gp61.1 GB:PROTEIN_ID AAQ81350.1 GB:DB_XREF GI:34732812 GB:GENE:GENE 61.1 LENGTH 64 SQ:AASEQ MKSFLECSGKLVSKGNKDTQVDEDMVAGDSGGNPTDIAAGKTSGAITSPGPETLGKKKNAKPKV GT:EXON 1|1-64:0| BL:SWS:NREP 1 BL:SWS:REP 21->54|Y01K_BPT4|7e-09|61.8|34/54| HM:PFM:NREP 2 HM:PFM:REP 19->63|PF07068|3.6e-09|40.0|45/493|Gp23| HM:PFM:REP 3->23|PF11006|0.00054|38.1|21/87|DUF2845| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-7,63-65| PSIPRED cccEEEEEEEEEccccccccHHHHHHcccccccHHHHHccccccEEccccHHHccHHHHccccc //