[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : 67
DDBJ      :67           prohead core protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->69 PF08512 * Rtt106 0.00087 39.4 33/140  
:BLT:SWISS 1->44 VPIP_BPT4 1e-06 52.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81476.1 GT:GENE 67 GT:PRODUCT prohead core protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 102338..102547 GB:FROM 102338 GB:TO 102547 GB:DIRECTION + GB:GENE 67 GB:PRODUCT prohead core protein GB:NOTE precursor to internal peptides; similar to T4 accession NP_049783.1; T4 gene synonym: pip; gp67 GB:PROTEIN_ID AAQ81476.1 GB:DB_XREF GI:34732938 GB:GENE:GENE 67 LENGTH 69 SQ:AASEQ MEKLMEAIKSGDLVEAKREFAARMEIVKESTLKQEKIAIARSIVTEGEEPKGKDGEDEDEDEDEDEEDE GT:EXON 1|1-69:0| BL:SWS:NREP 1 BL:SWS:REP 1->44|VPIP_BPT4|1e-06|52.3|44/80| SEG 46->68|egeepkgkdgedededededeed| HM:PFM:NREP 1 HM:PFM:REP 33->69|PF08512|0.00087|39.4|33/140|Rtt106| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,46-70| PSIPRED cHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcc //