[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81322.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->69 PF05576 * Peptidase_S37 0.00034 44.4 36/448  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81322.1 GT:GENE AAQ81322.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(2404..2670) GB:FROM 2404 GB:TO 2670 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81322.1 GB:DB_XREF GI:34732784 LENGTH 88 SQ:AASEQ MTLYEELNNALERVCRINIRFMGDQQHADELTENVSGPLERLRIGQASRRDMGVLCASGIVHEANLFGANIPNVIDEMIEKMKAEVQY GT:EXON 1|1-88:0| HM:PFM:NREP 1 HM:PFM:REP 33->69|PF05576|0.00034|44.4|36/448|Peptidase_S37| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,6-6,85-85,87-89| PSIPRED ccHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHccHHHHHHccHHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHHccc //