[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81323.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->79 PF02089 * Palm_thioest 0.00029 25.4 63/279  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81323.1 GT:GENE AAQ81323.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(3072..3338) GB:FROM 3072 GB:TO 3338 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81323.1 GB:DB_XREF GI:34732785 LENGTH 88 SQ:AASEQ MKAKFKSVEAKRAFIDQGEKEWATNNSDGSNNNWRIAKKFGMVEFDVKPLKGGIFSGWHDIYINGDLFDSISASEAMFFDFRDDRPGV GT:EXON 1|1-88:0| HM:PFM:NREP 1 HM:PFM:REP 15->79|PF02089|0.00029|25.4|63/279|Palm_thioest| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,23-27,87-89| PSIPRED cccHHHHHHHHHHHHHccHHHHcccccccccccEEEEEEEccEEEEEccccccccccEEEEEEEcHHccccccccEEEEEEccccccc //