[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81325.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81325.1 GT:GENE AAQ81325.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(3874..4125) GB:FROM 3874 GB:TO 4125 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81325.1 GB:DB_XREF GI:34732787 LENGTH 83 SQ:AASEQ MTIKRIRFKSEEHRKKFAESEWYNESFSKHMPDEFWAKYDSNKLVGYMLVDANGKKIELPEEEGGGGITFDDEEMFHFFDEVK GT:EXON 1|1-83:0| SEG 61->67|eeegggg| SEG 70->81|fddeemfhffde| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccEEEEEEccHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccEEEEEEEcccccEEEccHHHcccccEEcHHHHHHHHHHcc //