[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81328.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:138 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 30->114 YCF2_NANDO 3e-04 23.8 %
:PROS 72->88|PS00237|G_PROTEIN_RECEP_F1_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81328.1 GT:GENE AAQ81328.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(7301..7717) GB:FROM 7301 GB:TO 7717 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81328.1 GB:DB_XREF GI:34732790 LENGTH 138 SQ:AASEQ MNVITVNIFAIVILFIILLTILTQAKSSYWKSKAREFDDLREWAGSHDVFINWHSSQESPDRRTYVLRRKWVPNDALMMINVDRCKGIKFAELYARFRRIRELQYDGLSDVGVRDMLSTIAHDSQLERKQPVNFWKGY GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 30->114|YCF2_NANDO|3e-04|23.8|80/2299| PROS 72->88|PS00237|G_PROTEIN_RECEP_F1_1|PDOC00210| TM:NTM 1 TM:REGION 3->25| SEG 8->23|ifaivilfiilltilt| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEccccccEEEEEHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHccc //