[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81329.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->36 PF06305 * DUF1049 1.2e-05 27.3 33/80  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81329.1 GT:GENE AAQ81329.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(7719..8096) GB:FROM 7719 GB:TO 8096 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81329.1 GB:DB_XREF GI:34732791 LENGTH 125 SQ:AASEQ MFQIIFIAGLVLGLIACCFSTWDSRWRKKARNEQAKINTWLAKYGISMNFKNGVVGAFEKVVFFMPGGDNAIFSECKGINFRKAYKMLEQIRKDDIANPDFDQTGNLMSILYLSQAKIEKTIWDK GT:EXON 1|1-125:0| TM:NTM 1 TM:REGION 1->20| HM:PFM:NREP 1 HM:PFM:REP 4->36|PF06305|1.2e-05|27.3|33/80|DUF1049| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 30-31,125-126| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHEEcccccHHHHHHccccHHHHHHHHHHHHHHccccccHHcccccHHHHHHHHHHHHHHHccc //