[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81330.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 43->114 NIFU_AZOVI 5e-04 31.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81330.1 GT:GENE AAQ81330.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(8084..8629) GB:FROM 8084 GB:TO 8629 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81330.1 GB:DB_XREF GI:34732792 LENGTH 181 SQ:AASEQ MIRLKCNDREGLISFINKKSINRIGRRQNRSELIEAINTIEHQSYRQIDGIYHAVTPMSFKIEGDLNVFFDEVIKNVSIDLSSTFTASAVVPTRNMGFVMGKLVEEVGEFAKSINQPERCDERPVGEAADVINCVMDMLYLQYSEDNPGLGKSQIVDLIVKELNLQLNMKAEKWVEKACSK GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 43->114|NIFU_AZOVI|5e-04|31.4|70/312| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-7,181-182| PSIPRED cEEEEEccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcHHHHcccEEEEEcccHHHHHHHHHHHccEEccccEEEccccccccHHHHHHHHHHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccEEcHHHHHHHHHHcc //