Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81331.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:79 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81331.1 GT:GENE AAQ81331.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(8626..8865) GB:FROM 8626 GB:TO 8865 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81331.1 GB:DB_XREF GI:34732793 LENGTH 79 SQ:AASEQ MKIQMKLNVLPEYHAEYCKTQGQRLWASILEGKSKEGDLRVIEVMEDGGWKTNAEFLGYAIGIPVNEQKFFEEQFEVNV GT:EXON 1|1-79:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cEEEEEEEccHHHHHHHHHHcHHHHHHHHHccccccccEEEEEEEEcccccccccEEEEEEcccccHHHHHHHHHcccc //