[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81332.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->67 PF03864 * Phage_cap_E 0.00017 16.0 50/345  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81332.1 GT:GENE AAQ81332.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(8862..9080) GB:FROM 8862 GB:TO 9080 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81332.1 GB:DB_XREF GI:34732794 LENGTH 72 SQ:AASEQ MKIRLIDEKGFIDHCRKNIVDYKLARSIVDFTKTRELQIVQRDRGMWTLNVYGPLGKAQICRDQQKFFEVNQ GT:EXON 1|1-72:0| HM:PFM:NREP 1 HM:PFM:REP 18->67|PF03864|0.00017|16.0|50/345|Phage_cap_E| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,71-73| PSIPRED cEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEEccccHHHHHHHHHHHHcccc //