Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81333.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:108 amino acids
:HMM:PFM   11->66 PF05837 * CENP-H 0.00088 17.9 56/106  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81333.1 GT:GENE AAQ81333.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(9077..9403) GB:FROM 9077 GB:TO 9403 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81333.1 GB:DB_XREF GI:34732795 LENGTH 108 SQ:AASEQ MCRPNYRLLLAEEKSHGVEKELYELYTSMNAVGANNQDTFGKLFKTKAYKLAQTEIAEYNEKIRKVILKNFPTATRYQSELIGLRGIVDVSMKRGQRILIKLSYGELK GT:EXON 1|1-108:0| HM:PFM:NREP 1 HM:PFM:REP 11->66|PF05837|0.00088|17.9|56/106|CENP-H| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,108-109| PSIPRED cccccEEEEEEEHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHEEEcccccEEEEEEEccccc //