[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81336.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:158 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81336.1 GT:GENE AAQ81336.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(10068..10544) GB:FROM 10068 GB:TO 10544 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81336.1 GB:DB_XREF GI:34732798 LENGTH 158 SQ:AASEQ MDKQVNEVVVYLDIDGVLNTVSDHEIWRTDRASHLFRTSPYNHGDFVSNHRLSILREWLIRNNAKVVIVSSWVVLNDTGKMICDFLELPYHSEAYNTGGGQGRGTGVLKHAADHGIRRWVVIDDAKCMYDHSEVLLHHLVHIEGGLNESYLEEADFIL GT:EXON 1|1-158:0| SEG 97->106|tgggqgrgtg| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------11------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-4| PSIPRED cccccccEEEEEEccccccccHHHEEEEcccccEEEEccccccccEEHHHHHHHHHHHHHccccEEEEEEEEEEEcccHHHHHHHHccccEEEEEcccccccccHHHHHHHHHccccEEEEEEcHHHHcccHHHHHHccccccccccHHHHHHHHHcc //