[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81338.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:81 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->70 2d5wA PDBj 5e-04 33.3 %
:HMM:PFM   36->58 PF10826 * DUF2551 0.0006 30.4 23/83  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81338.1 GT:GENE AAQ81338.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(10915..11160) GB:FROM 10915 GB:TO 11160 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81338.1 GB:DB_XREF GI:34732800 LENGTH 81 SQ:AASEQ MIYEHFDKNSFWGSILIDGMKLNNKLSNIIMLPSTRKKLTEKYEFFAKSVGAMIGELHPTAKTWVAKPNPFRDGVLVEIRE GT:EXON 1|1-81:0| BL:PDB:NREP 1 BL:PDB:REP 2->70|2d5wA|5e-04|33.3|60/602| HM:PFM:NREP 1 HM:PFM:REP 36->58|PF10826|0.0006|30.4|23/83|DUF2551| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 74.1 SQ:SECSTR #EEEEEEEcccTTcHHHHHHTTTcHHHHHHHHHTccHHHHHH#########HHHTTccccccccccTTcT########### PSIPRED cccEEccccccEEEEEEEEEEccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccEEEEEEc //