[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81346.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:221 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->74 PF07007 * DUF1311 1.5e-07 28.3 53/95  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81346.1 GT:GENE AAQ81346.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(14916..15581) GB:FROM 14916 GB:TO 15581 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81346.1 GB:DB_XREF GI:34732808 LENGTH 221 SQ:AASEQ MKFLSVIALGLLSSSAMAASFDCNTTGLNSIEKAICKVPELSMMDQQLADAYKVVRHIPEVKADQKTFIKDRNSAPSLGDLKDLMRDRIIELEIIAELEGVEAKPYSERQVKPAKPIGSSSVGQLITQFKNGNTAVYNGQYLDATYRRSDAPSWALGCSAKIVDNDVLPKWAAEASKNKLSSEFADVRWKFDVAMFNATLANLLKNTDQSKTMCDIINVGM GT:EXON 1|1-221:0| SEG 8->20|algllsssamaas| SEG 89->99|iieleiiaele| HM:PFM:NREP 1 HM:PFM:REP 22->74|PF07007|1.5e-07|28.3|53/95|DUF1311| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,107-116| PSIPRED ccHHHHHHHHHHccccHHcccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccccEEEEccEEEcHHHccccccccccccccEEcccccccHHHHHHHHHHHHHHHHccEEEEEHHHHHHHHHHHHHcccccHHHHHHHcccc //