[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81347.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->49 PF02957 * TT_ORF2 4.7e-05 25.0 44/122  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81347.1 GT:GENE AAQ81347.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(15578..15748) GB:FROM 15578 GB:TO 15748 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81347.1 GB:DB_XREF GI:34732809 LENGTH 56 SQ:AASEQ MKSDLYKRGYKWANKAYQDGDTLQDIEDKADNSFDFNDFDRGALDAVHDLRKENKT GT:EXON 1|1-56:0| HM:PFM:NREP 1 HM:PFM:REP 6->49|PF02957|4.7e-05|25.0|44/122|TT_ORF2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,51-57| PSIPRED ccHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcc //