[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81368.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:187 amino acids
:PSIPRED
:HMM:PFM   7->51 PF02481 * DNA_processg_A 6.8e-06 37.8 45/212  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81368.1 GT:GENE AAQ81368.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(31708..32271) GB:FROM 31708 GB:TO 32271 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81368.1 GB:DB_XREF GI:34732830 LENGTH 187 SQ:AASEQ MAFYTGIGSRETPEHICRLMKDIAAVAAVRGYTGRSGGADGADDAFEQGFLAIAPELKPDNHAEFDVYIPWKRFNGRFAPKHERHNIITGGDSWKAFEIMKTIHPVYKKGGSLSRGAEQLHTRNVFQVLGYNLKTPSDFLVCYSIPTADGVSGGTNTAWQLALRHGVECYNLYNQFDIERLKEFLDL GT:EXON 1|1-187:0| SEG 37->45|ggadgadda| HM:PFM:NREP 1 HM:PFM:REP 7->51|PF02481|6.8e-06|37.8|45/212|DNA_processg_A| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1----------------------------1-----------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------1-------------111----------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccEEccccccccHHHHHHHHHHHHHHHHccEEEEEccccccHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccEEEcccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccHHHEEEEEEccccccccccHHHHHHHHHHcccEEEEccccHHHHHHHHHHcc //