[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81372.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->79 PF04701 * Pox_D2 0.00065 27.3 33/143  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81372.1 GT:GENE AAQ81372.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(33349..33711) GB:FROM 33349 GB:TO 33711 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81372.1 GB:DB_XREF GI:34732834 LENGTH 120 SQ:AASEQ MNVTIYECEFTGVVPGRMIKSYYEHADVPTLKTLGFKVEWSVVHLAGGAVYRARIYKGRSDRFDRSTSFPIVRKIFKDCDATNVFMCDHTPSHMQYMKVGQDVYEICKCHDCGASFKFEV GT:EXON 1|1-120:0| HM:PFM:NREP 1 HM:PFM:REP 46->79|PF04701|0.00065|27.3|33/143|Pox_D2| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEEEEEEccccHHHHHHHHHHcccccEEEEEEEEEEEEEEEEccEEEEEEEEcccccccccccccHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccEEEEc //