[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81380.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:32 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81380.1 GT:GENE AAQ81380.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(36941..37039) GB:FROM 36941 GB:TO 37039 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81380.1 GB:DB_XREF GI:34732842 LENGTH 32 SQ:AASEQ MEGYIVKNKFVRTDEESQSKEVEKENPKEAEE GT:EXON 1|1-32:0| SEG 20->31|kevekenpkeae| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,12-33| PSIPRED cccEEEcccEEccccHHHHHHHHHHcHHHHcc //