[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81382.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->48 PF09478 * CBM49 5.2e-05 31.6 38/80  
:REPEAT 2|34->50|60->72

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81382.1 GT:GENE AAQ81382.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(38020..38238) GB:FROM 38020 GB:TO 38238 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81382.1 GB:DB_XREF GI:34732844 LENGTH 72 SQ:AASEQ MARSDVLVEKAKELQKLLIEVNDLASENNYGVQINSDNSIEFDDWLSSSCYGEGDEAFNIESDGSVWMSSSC GT:EXON 1|1-72:0| NREPEAT 1 REPEAT 2|34->50|60->72| HM:PFM:NREP 1 HM:PFM:REP 10->48|PF09478|5.2e-05|31.6|38/80|CBM49| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccEEHHHHHHcccccccccEEEEcccccEEEEccc //