[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81387.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   34->82 PF08323 * Glyco_transf_5 0.00092 21.4 42/241  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81387.1 GT:GENE AAQ81387.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(41352..41621) GB:FROM 41352 GB:TO 41621 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81387.1 GB:DB_XREF GI:34732849 LENGTH 89 SQ:AASEQ MNMDINDYAKEFTREIGRNIHVNLLSTDPEQVKSTIFWTFPGITEVRIGSSTYFAQNGKIYNATIDYNAKRVIMAGEANAETNTEIYTV GT:EXON 1|1-89:0| HM:PFM:NREP 1 HM:PFM:REP 34->82|PF08323|0.00092|21.4|42/241|Glyco_transf_5| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 62 STR:RPRED 69.7 SQ:SECSTR ######cHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcTTccEEEEEEEETTcccccccccEEEEE##################### DISOP:02AL 1-5,83-83| PSIPRED ccccHHHHHHHHHHHHccEEEEEEEEccHHHHEEEEEEEccccEEEEEcccEEEEcccEEEEEEEEccccEEEEEcccccccccEEEEc //