[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81388.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:68 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   29->47 PF10945 * DUF2629 0.00025 31.6 19/44  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81388.1 GT:GENE AAQ81388.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(41618..41824) GB:FROM 41618 GB:TO 41824 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81388.1 GB:DB_XREF GI:34732850 LENGTH 68 SQ:AASEQ MQIKLTKEDWESAKYQNDQNEYPVELELFDQLKTVFSIPQIKYVYLSYEEFNSIMPFIPRRSGFSHVR GT:EXON 1|1-68:0| HM:PFM:NREP 1 HM:PFM:REP 29->47|PF10945|0.00025|31.6|19/44|DUF2629| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,7-7,65-69| PSIPRED ccEEEEHHHHHHHHcccccccccEEHHHHHHHHHHHccccEEEEEEEHHHHccccccccccccccccc //