[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81389.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->29 PF08020 * DUF1706 0.00077 41.7 24/166  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81389.1 GT:GENE AAQ81389.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(41809..42084) GB:FROM 41809 GB:TO 42084 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81389.1 GB:DB_XREF GI:34732851 LENGTH 91 SQ:AASEQ MNRIKELFDKAVKWYEQEWYYGKWIVSGNADSYLVKYLTFDGEFGLVPSFYSQYYDGHKLNRLRLFVVSIEWGHVVYSKNQWEKEMKCKSN GT:EXON 1|1-91:0| HM:PFM:NREP 1 HM:PFM:REP 5->29|PF08020|0.00077|41.7|24/166|DUF1706| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,89-92| PSIPRED ccHHHHHHHHHHHHHHHccEEEEEEEEccccEEEEEEEEEcccccccHHHHHHHccccEEEEEEEEEEEEEEEEEEEEccHHHHHHHcccc //