[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81392.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:216 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   185->214 PF12128 * DUF3584 6e-04 36.7 %
:HMM:PFM   183->214 PF05565 * Sipho_Gp157 7.8e-06 34.4 32/162  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81392.1 GT:GENE AAQ81392.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(43756..44406) GB:FROM 43756 GB:TO 44406 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81392.1 GB:DB_XREF GI:34732854 LENGTH 216 SQ:AASEQ MTKHKDLNRFLKNTHDTTGNKYRKSRDLNSRFADKHHFMRLLNNLLPSEMKWSSFGSRFGIAKISPNHINLAAVGTHSVCGTIWVNTSFESDCVTNRLQTLEAYGVFVEVARRTNGSNHVVTFSVDLPNGDKAPVKNVETKTEVVSTVDYTEPAKEPDGQNIFFAPETMQAVQLVRGVFHFASVRISEIDEEIKELQARRKEIEDNIKSIKNAIGA GT:EXON 1|1-216:0| RP:PFM:NREP 1 RP:PFM:REP 185->214|PF12128|6e-04|36.7|30/1179|DUF3584| HM:PFM:NREP 1 HM:PFM:REP 183->214|PF05565|7.8e-06|34.4|32/162|Sipho_Gp157| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,199-200,216-217| PSIPRED cccHHHHHHHHHHccccccHHHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccEEEcccccEEEEEEEccccEEEEEEcccccHHHHHHHHHHHHHHEEEEEEEEccccccEEEEEEEEccccccccccccccHHHHHHccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //