Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81393.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:48 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81393.1 GT:GENE AAQ81393.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(44403..44549) GB:FROM 44403 GB:TO 44549 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81393.1 GB:DB_XREF GI:34732855 LENGTH 48 SQ:AASEQ MSTKNIVINAGYIASFGLFYAMYKGDAYFVLGCAAAVIGSTIIARLIK GT:EXON 1|1-48:0| TM:NTM 2 TM:REGION 2->23| TM:REGION 25->47| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccEEEEEHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHc //