Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81396.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:106 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81396.1 GT:GENE AAQ81396.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(45599..45919) GB:FROM 45599 GB:TO 45919 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81396.1 GB:DB_XREF GI:34732858 LENGTH 106 SQ:AASEQ MEIDDHKSWVWISSEGYPHVVIGCSEHPIEEIVENEHFESHTGFENVKQRLLDNYGHHDVKMLEEELPWVTTALNHAAAGRTLSYIGLCDRSGMNIINSFFVIGCS GT:EXON 1|1-106:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccEEEEEEcccccEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHHHcccEEEEEEEEccccHHHHHHEEEEEEc //