[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81398.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->76 PF01226 * Form_Nir_trans 0.00013 19.0 58/250  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81398.1 GT:GENE AAQ81398.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(46227..46472) GB:FROM 46227 GB:TO 46472 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81398.1 GB:DB_XREF GI:34732860 LENGTH 81 SQ:AASEQ MKITKATNLQSIDFAKRQSAKEIANKPVTRIDAITGTFATTMIGVGAAMCAVGETAMAIKTFGATIVFSLVVIAITRGLNK GT:EXON 1|1-81:0| TM:NTM 2 TM:REGION 31->53| TM:REGION 59->81| HM:PFM:NREP 1 HM:PFM:REP 18->76|PF01226|0.00013|19.0|58/250|Form_Nir_trans| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,21-22,80-82| PSIPRED cccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //