[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81400.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81400.1 GT:GENE AAQ81400.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(47531..48034) GB:FROM 47531 GB:TO 48034 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81400.1 GB:DB_XREF GI:34732862 LENGTH 167 SQ:AASEQ MKDICIRKKVKSTKQKRIAPADVFKYKDGRWECITVNSNSTENPVLVIRKKMTRIVMIIELRLLNGICCFDFKEVSPDGIRCWSDICANSEINITGGNFTIADEIEETVSVPIEVGDTFNHKWDVKYVVKFIADDGSLIAWDEERRKSIFVNRNDRDQLKAYGMTLN GT:EXON 1|1-167:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,13-15| PSIPRED cccHHHHHHHHHHHHccccHHHEEEEccccEEEEEEccccccccEEEEEEcccEEEEEEEEEEEccEEEEEHHHcccccEEEHHHHccccEEEEEcccEEEHHHHHHEEEcEEEEcccccccEEHHHHEEEHHccccEEEEcHHHEEEEEEccccHHHHHHcccccc //