Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81401.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:114 amino acids
:BLT:SWISS 71->108 GATB_BORRA 6e-04 42.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81401.1 GT:GENE AAQ81401.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(48034..48378) GB:FROM 48034 GB:TO 48378 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81401.1 GB:DB_XREF GI:34732863 LENGTH 114 SQ:AASEQ MQFYKFKDDSELIEEFINGTGVNKVIHRILGKWIFGLVNTGNKNHFIAIDRNGQRINSGYDYEFNASEVSKYLEITDAPLIESGDLIEWVKNHNLGELPFDKVLKMYEIAVGEI GT:EXON 1|1-114:0| BL:SWS:NREP 1 BL:SWS:REP 71->108|GATB_BORRA|6e-04|42.1|38/485| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccEEcHHHHHHHHHHcccccccccHHHHHHHHcccccccHHHHHHHHHHHHccc //