[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81403.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  9/199 : Viruses  1/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   2->46 PF05154 * TM2 1e-04 53.3 %
:HMM:PFM   2->49 PF05154 * TM2 8e-22 58.3 48/51  
:BLT:SWISS 2->62 TM2D1_DICDI 2e-15 47.5 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81403.1 GT:GENE AAQ81403.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(49514..49756) GB:FROM 49514 GB:TO 49756 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE matches Pfam TM2 domain E GB:PROTEIN_ID AAQ81403.1 GB:DB_XREF GI:34732865 LENGTH 80 SQ:AASEQ MKSTAIAYVLWFFLGFLGIHRFYTGNIATGIIWLFTGGLFGIGWFIDLFLTAGLVQSSNVRWRLEQAEMNFAINSYKNRG GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 2->62|TM2D1_DICDI|2e-15|47.5|61/153| TM:NTM 2 TM:REGION 2->24| TM:REGION 33->55| RP:PFM:NREP 1 RP:PFM:REP 2->46|PF05154|1e-04|53.3|45/53|TM2| HM:PFM:NREP 1 HM:PFM:REP 2->49|PF05154|8e-22|58.3|48/51|TM2| OP:NHOMO 53 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------111------------------11-1--------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11-1---------------1-------1--------------------------------1---------------------------------------------------------------------------------------------------------------------------------------1-1----------------------------2221-1111-11-11---------------1----------------------------------------------------------------------------------- ----34-----2-----------------------------------------------------------------------------------------------1-3-----------------------------------------------------12--------11------------------------ -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,77-81| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //