[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81404.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
e.8.1
:122 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  55->113 1u09A  e.8.1.4 * 2e-04 22.0 %
:HMM:PFM   96->114 PF10393 * Matrilin_ccoil 9.6e-05 63.2 19/47  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81404.1 GT:GENE AAQ81404.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(49753..50121) GB:FROM 49753 GB:TO 50121 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81404.1 GB:DB_XREF GI:34732866 LENGTH 122 SQ:AASEQ MRIERYAFADAEAIADFTAVVGSVETNTQIADIVGLRPFYIVFDGYDSAIEIRETKGGLSLASDYDPVFFPNEIEQYLKRLPDVADINDELTHAELLEKLEDVQKRLAAVEDRLKQLEGVAK GT:EXON 1|1-122:0| HM:PFM:NREP 1 HM:PFM:REP 96->114|PF10393|9.6e-05|63.2|19/47|Matrilin_ccoil| RP:SCP:NREP 1 RP:SCP:REP 55->113|1u09A|2e-04|22.0|59/476|e.8.1.4| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,120-123| PSIPRED cccEEEHHccHHHHHHHHHHHHccccccHHHHHHccccEEEEEcccccEEEEEEccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //