[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81406.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:105 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   72->97 PF04761 * Phage_Treg 0.00092 42.3 26/57  
:BLT:SWISS 14->100 GLMS_SYNY3 9e-04 31.8 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81406.1 GT:GENE AAQ81406.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(50748..51065) GB:FROM 50748 GB:TO 51065 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81406.1 GB:DB_XREF GI:34732868 LENGTH 105 SQ:AASEQ MNIQKEIQEIEKRLGVEASEFKMPSVWKVARKPDWSYGAVFEQEFTAYEHKELGCFVAVYSERHRAQFVNTEGEDVIGHTERVVSVQHVEPYKTRLGTSWRVVNA GT:EXON 1|1-105:0| BL:SWS:NREP 1 BL:SWS:REP 14->100|GLMS_SYNY3|9e-04|31.8|85/631| HM:PFM:NREP 1 HM:PFM:REP 72->97|PF04761|0.00092|42.3|26/57|Phage_Treg| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccHHHHHHHHHHHHcccHHHccccHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHcccccHHHccccEEEEEEEcccHHHcccccEEEEcc //