[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81407.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->62 PF12441 * DUF3680 7.2e-05 50.0 22/42  
:HMM:PFM   21->51 PF10739 * DUF2550 0.00046 29.0 31/129  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81407.1 GT:GENE AAQ81407.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(51067..51267) GB:FROM 51067 GB:TO 51267 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81407.1 GB:DB_XREF GI:34732869 LENGTH 66 SQ:AASEQ MKTKFKMPTSGQFVATWIHNHKPWADTFKWCHGVLKVANEHGDFYETVDLSDYRDVFKNAKFLMVK GT:EXON 1|1-66:0| HM:PFM:NREP 2 HM:PFM:REP 41->62|PF12441|7.2e-05|50.0|22/42|DUF3680| HM:PFM:REP 21->51|PF10739|0.00046|29.0|31/129|DUF2550| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccEEccccccccHHHHHHccccHHHHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHccccEEEEc //