[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81414.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->51 PF00479 * G6PD_N 0.00075 22.0 41/183  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81414.1 GT:GENE AAQ81414.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(54121..54309) GB:FROM 54121 GB:TO 54309 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81414.1 GB:DB_XREF GI:34732876 LENGTH 62 SQ:AASEQ MIFEIDSEKGIEAKAKFLENLKWCADDLDRKTTFRMLSNVIGYEEARRYANGHGLHNSYYFS GT:EXON 1|1-62:0| HM:PFM:NREP 1 HM:PFM:REP 11->51|PF00479|0.00075|22.0|41/183|G6PD_N| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7,57-58| PSIPRED cEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc //