[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81415.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:202 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->55 PF03743 * TrbI 3e-04 46.7 %
:RPS:PFM   47->170 PF06693 * DUF1190 3e-07 31.1 %
:HMM:PFM   47->202 PF06693 * DUF1190 1.7e-22 26.7 150/166  
:BLT:SWISS 46->156 Y3956_PHOLL 9e-07 32.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81415.1 GT:GENE AAQ81415.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(54384..54992) GB:FROM 54384 GB:TO 54992 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81415.1 GB:DB_XREF GI:34732877 LENGTH 202 SQ:AASEQ MQKQLKMGIMAAFVSAALSGCGQANTDDTFTYNGLGGEATPTVTAVSAQQCAELGGGSLEQCQSAFDKAKMEHIDSAPKFNDQASCESGTEAICNRTQIQNSDGSFSDVFVPAMVGMIVGQMMSNNSRPMPVYAPARPEDRKNGFVTSGGAYVPPAKGSVGANTFSAPKTPGSFSKPSPSSKPSFSSKGGFGKSGSFGSSGG GT:EXON 1|1-202:0| BL:SWS:NREP 1 BL:SWS:REP 46->156|Y3956_PHOLL|9e-07|32.7|110/234| SEG 171->201|pgsfskpspsskpsfsskggfgksgsfgssg| RP:PFM:NREP 2 RP:PFM:REP 11->55|PF03743|3e-04|46.7|45/192|TrbI| RP:PFM:REP 47->170|PF06693|3e-07|31.1|122/166|DUF1190| HM:PFM:NREP 1 HM:PFM:REP 47->202|PF06693|1.7e-22|26.7|150/166|DUF1190| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,100-104,127-133,168-195,197-203| PSIPRED ccccHHHHHHHHHHHHHHHHccccccccHHHHcccccccccEEEEEcHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHcccccccccHHHHccccccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccc //