[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81416.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
d.24.1
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  4->29 1oqwA_ d.24.1.1 * 1.4e-12 65.4 %
:HMM:PFM   2->21 PF07963 * N_methyl 3.6e-10 55.0 20/20  
:HMM:PFM   30->57 PF01176 * eIF-1a 0.00033 25.0 28/65  
:PROS 2->22|PS00409|PROKAR_NTER_METHYL
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81416.1 GT:GENE AAQ81416.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(54997..55215) GB:FROM 54997 GB:TO 55215 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81416.1 GB:DB_XREF GI:34732878 LENGTH 72 SQ:AASEQ MKGFTLIELMIVVVIIAILAAIAIPAFSSNEIYNPVERACPNGMATALTPAGEEVLVCRKTPVNAGSFKIED GT:EXON 1|1-72:0| PROS 2->22|PS00409|PROKAR_NTER_METHYL|PDOC00342| TM:NTM 1 TM:REGION 7->29| SEG 6->26|lielmivvviiailaaiaipa| HM:PFM:NREP 2 HM:PFM:REP 2->21|PF07963|3.6e-10|55.0|20/20|N_methyl| HM:PFM:REP 30->57|PF01176|0.00033|25.0|28/65|eIF-1a| HM:SCP:REP 4->29|1oqwA_|1.4e-12|65.4|26/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,71-73| PSIPRED cccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccHHHHccccccEEEEEEccccccccEEEcc //