[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81418.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->70 PF05116 * S6PP 0.00069 20.0 65/247  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81418.1 GT:GENE AAQ81418.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(56208..56471) GB:FROM 56208 GB:TO 56471 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81418.1 GB:DB_XREF GI:34732880 LENGTH 87 SQ:AASEQ MKSSDVYAQVLMAQQFATEELKRKLAPVGKFVADEMIRQRSFKISFDVAKFPAIMPKDIVDYLRSLGYDAKSDSFRNESVITVTAKP GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 5->70|PF05116|0.00069|20.0|65/247|S6PP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,87-88| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEHHHcccccHHHHHHHHHHcccccccccccccEEEEEEccc //