[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81420.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
d.63.1
:157 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   4->142 2eenB PDBj 1e-09 19.1 %
:RPS:SCOP  4->147 2fblA1  d.63.1.2 * 4e-23 28.0 %
:HMM:SCOP  1->154 2fblA1 d.63.1.2 * 3.2e-19 34.9 %
:HMM:PFM   22->54 PF02114 * Phosducin 0.00062 30.3 33/265  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81420.1 GT:GENE AAQ81420.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(57119..57592) GB:FROM 57119 GB:TO 57592 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81420.1 GB:DB_XREF GI:34732882 LENGTH 157 SQ:AASEQ MALEIERKWVVPVFPFKKNVTYRKQDIAQFYHKGARYRSVMEAGCEEVFIKTVKTGLGLIREEIETFISRDEAWEIHRMAGYPECIVKQRWFIPTGYSHHIIELDILKTGEIYAEIEFKSEYDALNFTAIPTWFGPEVTEDIFHTNYEIYKRLNGVF GT:EXON 1|1-157:0| RP:PDB:NREP 1 RP:PDB:REP 4->142|2eenB|1e-09|19.1|136/163| HM:PFM:NREP 1 HM:PFM:REP 22->54|PF02114|0.00062|30.3|33/265|Phosducin| RP:SCP:NREP 1 RP:SCP:REP 4->147|2fblA1|4e-23|28.0|132/144|d.63.1.2| HM:SCP:REP 1->154|2fblA1|3.2e-19|34.9|146/0|d.63.1.2|1/1|CYTH-like phosphatases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 144 STR:RPRED 91.7 SQ:SECSTR #cEcEEEEEEccHcEEEEEEEEEEEEEEcccccHHHHTcEEEEEEEETTEEEEEEEEcccEEEEEEcccHHHHHHHHHHTTcEEEEEEEEEEEEEE#TTEEEEEEEETTTEEEEEEEEcccHHHGHHHHHHHHTTccccccccccc########### DISOP:02AL 1-1| PSIPRED ccccEEEEEEEcccHHHHccccccEEEEEEccccccccEEEEEEEccEEEEEEccccccccccEEEcccHHHHHHHHHHcccccEEEEEEEEEEccccEEEEEEEcccccEEEEEEEcccccccccccccccccccHHcccHHHHHHHHHHHHHccc //