Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81421.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:110 amino acids
:HMM:PFM   16->59 PF09314 * DUF1972 9.8e-05 21.4 42/185  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81421.1 GT:GENE AAQ81421.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(57582..57914) GB:FROM 57582 GB:TO 57914 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81421.1 GB:DB_XREF GI:34732883 LENGTH 110 SQ:AASEQ MKFPKHLLRELIGEKFEIVPGEGVPSDFCGSYETLVNDIIDQGRWTVEYDFVFSFEKDMIKRNFRAPYRTGATECQDEMPWENEGEFVEAEEVEQYEVVTVGYRRKHNGA GT:EXON 1|1-110:0| SEG 82->101|enegefveaeeveqyevvtv| HM:PFM:NREP 1 HM:PFM:REP 16->59|PF09314|9.8e-05|21.4|42/185|DUF1972| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,106-111| PSIPRED cccHHHHHHHHHcccEEEcccccccHHHHccHHHHHHHHHHccEEEEEEEEEEEHHHHHHHHHccccccccccHHHccccccccccEEEHHHHcEEEEEEEEEEEccccc //